The NCBI web site (http://www.ncbi.nlm.nih.gov) can also be used to search for protein sequences. Instead of performing a BLAST search with a nucleic acid query, one performs a protein blast with a polypeptide (amino acid sequence) query. Assume that you have the following partial sequence of a polypeptide:

GYDVEKNNSRIKLGLKSLVSKGILVQTKGTGASGSFKLNKKAASGEAKPQAKKAGAAKA

Go to the NCBI web site and access the BLAST tool. Then click on protein blast and enter the query sequence in the box at the top. Then click BLAST. What is the identity of your query sequence?