1.make a figure using PyMol or Chimera of the coronavirus protease. PDB ID:6LU7

1. Sometimes the protein you are interested in does not have an experimentally determined structure. Thus, you may need to predict its structure using bioinformatics tools.Given the protein sequence below use SWISS-MODEL to generate a homology model of the protein.

(Go here to access SWISS-MODEL:https://swissmodel.expasy.org/interactive)

>sp|P04142|CECB_BOMMO Cecropin-B OS=Bombyx mori OX=7091 GN=CECB1 PE=1 SV=2

MNFAKILSFVFALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAIGK

1.Snip the results below of the template search.

2.Pick the best template(s) to use as a model.

3.Once you have chosen your template(s) download the PDB format file of your model(s) and using PyMOL or chimera post the structure in the cartoon representation.