Question
A protein sequence and the secondary structure is shown as following: Protein Sequence: FATQVYCKWRY HQGRDVDF EATWDTVRDIVLKKFA SS Annotation: EEEEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHH Calculate the Mathews Correlation Coefficient (MCC)
A protein sequence and the secondary structure is shown as following:
Protein Sequence: FATQVYCKWRYHQGRDVDFEATWDTVRDIVLKKFA
SS Annotation: EEEEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHH
Calculate the Mathews Correlation Coefficient (MCC) score of the prediction accuracy for this protein sequence.
Step by Step Solution
3.46 Rating (153 Votes )
There are 3 Steps involved in it
Step: 1
The MCC score of the prediction accuracy for this protein sequence is 05452 This value indicates the ...
Get Instant Access to Expert-Tailored Solutions
See step-by-step solutions with expert insights and AI powered tools for academic success
Step: 2
Step: 3
Ace Your Homework with AI
Get the answers you need in no time with our AI-driven, step-by-step assistance
Get Started
Statistics Learning From Data
Authors: Roxy Peck
1st Edition
495553263, 978-1285966083, 1285966082, 978-0495553267
