can you answer this think pair share

ANDOUT Zinc Fingers In the article "LMO2 at 25 Years: A Paradigm of Chromosomal Translocation Proteins, the authors review the structure of a group of proteins called LIM-domain-only proteins, abbreviated LMOI, LMO2. LMO3, and LM04, that are proto-oncogenes. Some types of leukemia involve translocations in these genes The proteins contain DNA binding domains, and in the article, the LIM domains of the LMO2 zinc finger regions are compared. There are three zinc fingers. A figure from the paper that compares the human and mouse primary sequences is shown here Human: MSSAIERKSLDPSEEPVDEVLQIPPSLLT GGCQQNIGORYFLKAIDQYWHEDOLSC Mouse: **** Human: DLOGCRLGEVGRRLYYKLGRKLCRRDYLRLFGOOGLCASCDKRIRAYEMTMRVKDKV Mouse: ** Human: YHLECEKCAACQKHFCVGDRYLLINSDIVCEQOIYEWTKINGMI Mouse: **** ********* Mouse: THINK provided acids that in the binding met Hint Remember that there are thrine Fingers Sketch the approximate secondary structure of the protein in this region showing the zinc fingers and link regions. PAIR Converse you down with another student's drawing are they umiart Hawa you identified the same critical SHARE of homology between the mice and human sequences in this region. Then discuss what would happen if this region, or part of it were lost from the moved to a different region Chambers, and T H Rabbitts, "LMO2 at 25 years. A paradigm of chromosom anslocation proteins. Open Bow 5, 6 (2015), 150062 do 10.1098/rsb. 150062