can you answer the think pair share

participated mune HANDOUT Zinc Fingers - 2rus sha than - Zhu -3 fingers lowy endus or 3 M in the article L.MO2 at 25 Years A Paradigm of Chromosomal Translocation Proteins, the authors review the structure of a group of proteins called LIM domain only proteins, abbreviated LMOI, LMO2. L.MO3, and LM04, that are proto-oncogenes Some types of lokma involve translocations in these genes The proteins contain DNA binding domains, and in the article, the LIM domains of the LMO2 Dinc finger regions are compared. There are three zinc fingers A figure from the paper that compares the human and mouse primary sequences is showed here Huaran: MSSATER SLOPSEEPVDEV.QIPPSLLTCGG QONIGDRYFLKAIDQYWHEELS Mouse: * Human: DLUGCRLGEVGRALYYKLGRKLCRROYLRLFGQDG CASCDKRIRAYEMTMRVKDV Mouse: Human: YHLECFKCAACQKHFCVGDRYLLINSDIVCEQOIYEWTKINGMI Mouse: **** ******* TIM Examine the sequence provided. Find and circle the sets of the amino Human Uu Mouse: **** Humah YHLECKLACHCVGORYLLINSDIVCETYEWTXING Mouse cco THINK acids that define the cinc-binding motif (HintRemember that the the zinc finger) Sketch the approximate secondary structure of the protein in this pion, showing the tine Fingers and link regions PAIR they similart Hava you identified the same amino acid sites as being critical Share your drawing with the class. Discuss the large amount of sequeno SHARE , Then discuss what would happen if this region, or part of it were lost from the gans of moved to a different region participated mune HANDOUT Zinc Fingers - 2rus sha than - Zhu -3 fingers lowy endus or 3 M in the article L.MO2 at 25 Years A Paradigm of Chromosomal Translocation Proteins, the authors review the structure of a group of proteins called LIM domain only proteins, abbreviated LMOI, LMO2. L.MO3, and LM04, that are proto-oncogenes Some types of lokma involve translocations in these genes The proteins contain DNA binding domains, and in the article, the LIM domains of the LMO2 Dinc finger regions are compared. There are three zinc fingers A figure from the paper that compares the human and mouse primary sequences is showed here Huaran: MSSATER SLOPSEEPVDEV.QIPPSLLTCGG QONIGDRYFLKAIDQYWHEELS Mouse: * Human: DLUGCRLGEVGRALYYKLGRKLCRROYLRLFGQDG CASCDKRIRAYEMTMRVKDV Mouse: Human: YHLECFKCAACQKHFCVGDRYLLINSDIVCEQOIYEWTKINGMI Mouse: **** ******* TIM Examine the sequence provided. Find and circle the sets of the amino Human Uu Mouse: **** Humah YHLECKLACHCVGORYLLINSDIVCETYEWTXING Mouse cco THINK acids that define the cinc-binding motif (HintRemember that the the zinc finger) Sketch the approximate secondary structure of the protein in this pion, showing the tine Fingers and link regions PAIR they similart Hava you identified the same amino acid sites as being critical Share your drawing with the class. Discuss the large amount of sequeno SHARE , Then discuss what would happen if this region, or part of it were lost from the gans of moved to a different region