Answered step by step
Verified Expert Solution
Link Copied!

Question

1 Approved Answer

CODE MUST BE IN R ## GC-content of a piece of DNA is defined as the percentage of Gs + Cs. ## For example ACCTGCA

CODE MUST BE IN R

## GC-content of a piece of DNA is defined as the percentage of Gs + Cs. ## For example "ACCTGCA" has a 57.1% GC-content ## Write a function that will take a text file in FASTA format as input. ## FASTA format: A sequence record in a FASTA format consists of a single-line description (sequence name), followed by line(s) of sequence data. ## The first character of the description line is a greater-than (">") symbol. ## FASTA format Example: ## >seq0 ## FQTWEEFSRAAEKLYLADPMKVRVVLKYRHVDGNLCIKVTDDLVCLVYRTDQAQDVKKIEKF ## >seq1 ## KYRTWEEFTRAAEKLYQADPMKVRVVLKYRHCDGNLCIKVTDDVVCLLYRTDQAQDVKKIEKFHSQLMRLME LKVTDNKECLKFKTDQAQEAKKMEKLNNIFFTLM ## The output should be the sequence id with the lowest GC content followed by the calculated value gc_calculator = function ( fasta_file) {

}

Step by Step Solution

There are 3 Steps involved in it

Step: 1

blur-text-image

Get Instant Access to Expert-Tailored Solutions

See step-by-step solutions with expert insights and AI powered tools for academic success

Step: 2

blur-text-image

Step: 3

blur-text-image

Ace Your Homework with AI

Get the answers you need in no time with our AI-driven, step-by-step assistance

Get Started

Students also viewed these Databases questions