Given a mixture of the following polypeptides: TTSAAYDRAVALAISLLYYVISLLDDKAVASLLATYSSLATSSVTYSSLA LLWVAFGAVWYINCCVAILLINDWLVVVAILLALLQVAFGLYINCCVAILLINDWYVVVAILLAVVAILLALLQVALLQVAFGLYIN AVDAAAEVAEAADVVADLAAEVVELAAEVVE LAKVAAKALRAAIKAARLAVRAAKLAVRAAK 1. The protein mixture is run through several separation techniques, depicted below, one after the other. The elution from each previous step is used for the next step. Predict the polypeptide to separate out from the mixture at each step of the following chromatography scheme. Be carefull Consider whether you would have any complexes forming. 1. Sucrose Gradient II. Gel filtration chromatography III. Cation Exchange chromatography