Zinc Fingers us hu -3 fingers In the article "LMO2 at 25 Years: A Paradigm of Chromosomal Translocation Proteins. the authors review the structure of a group of proteins called LIM-domain-only proteins, abbreviated a LMOI, LMO2. LMO3, and LMO4, that are proto-oncogenes. Some types of leukemia involve translocations in these genes. The proteins contain DNA binding domains, and in the article, the LIM domains of the LMO2 zinc finger regions are compared. There are three zinc fingers. A figure from the paper that compares the human and mouse primary sequences is shown here Human: MSSAIERKSLOPSEEPVDEVLQIPPSLLTCGGCOQNIGDRYFLKAIDQYWHEDALSC Mouse: Human: DLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGOOGLCASCDKRIRAYEMTMRVKDKV Mouse: Human: YHLECEK CAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI Mouse: **** ***** . Examine the sequence provided. Find and circle the sets of the amino THINK three zinc fingers!) Sketch the approximate secondary structure of the protein in this region, showing the zinc fingers and link regions. PAIR Compare your drawing with another student's drawing Are they similar? Have you identified ? SHARE Share your drawing with the class. Discuss the large amount of sequence homology between the mice and human sequences in this region. Then discuss what would happen if this region, or part of it, were lost from the gene or moved to a different region s Chambers, J.. and T. H. Rabbitts, "LMO2 at 25 years: A paradigm of chromosomal translocation proteins, Oper Biology 5, no. 6 (2015): 150062. doi:10.1098/rsob. 150062 HANDOUT Logic Diagrams on Gene Regulation Prokaryotic and eukaryotic genes, pone mutation, and gene worden share many cominica structures and mechanisms but very greatly in other moects. For example, prokaryotic Protein-coding genes are rapid in operon, whereas aryatic pratos coding genes ar anch regulated by a specific promoter. However, each has an upcom region at which the RNA polymerase machinery binds Using the following Venn diagram.compare and contrast what we know about the mothanisms or how we could investigate the genis your instructor mitt ansiga specific category for you to consider Prokaryotic Eukaryotic Shared Zinc Fingers us hu -3 fingers In the article "LMO2 at 25 Years: A Paradigm of Chromosomal Translocation Proteins. the authors review the structure of a group of proteins called LIM-domain-only proteins, abbreviated a LMOI, LMO2. LMO3, and LMO4, that are proto-oncogenes. Some types of leukemia involve translocations in these genes. The proteins contain DNA binding domains, and in the article, the LIM domains of the LMO2 zinc finger regions are compared. There are three zinc fingers. A figure from the paper that compares the human and mouse primary sequences is shown here Human: MSSAIERKSLOPSEEPVDEVLQIPPSLLTCGGCOQNIGDRYFLKAIDQYWHEDALSC Mouse: Human: DLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGOOGLCASCDKRIRAYEMTMRVKDKV Mouse: Human: YHLECEK CAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI Mouse: **** ***** . Examine the sequence provided. Find and circle the sets of the amino THINK three zinc fingers!) Sketch the approximate secondary structure of the protein in this region, showing the zinc fingers and link regions. PAIR Compare your drawing with another student's drawing Are they similar? Have you identified ? SHARE Share your drawing with the class. Discuss the large amount of sequence homology between the mice and human sequences in this region. Then discuss what would happen if this region, or part of it, were lost from the gene or moved to a different region s Chambers, J.. and T. H. Rabbitts, "LMO2 at 25 years: A paradigm of chromosomal translocation proteins, Oper Biology 5, no. 6 (2015): 150062. doi:10.1098/rsob. 150062 HANDOUT Logic Diagrams on Gene Regulation Prokaryotic and eukaryotic genes, pone mutation, and gene worden share many cominica structures and mechanisms but very greatly in other moects. For example, prokaryotic Protein-coding genes are rapid in operon, whereas aryatic pratos coding genes ar anch regulated by a specific promoter. However, each has an upcom region at which the RNA polymerase machinery binds Using the following Venn diagram.compare and contrast what we know about the mothanisms or how we could investigate the genis your instructor mitt ansiga specific category for you to consider Prokaryotic Eukaryotic Shared
