Identify a 20-residue segment that could form a transmembrane helix in this protein sequence (from the

Question:

Identify a 20-residue segment that could form a transmembrane α helix in this protein sequence (from the mosquito protein Orco).

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNTGDVNELTANTITT

Fantastic news! We've Found the answer you've been seeking!

Step by Step Answer:

Related Book For  book-img-for-question

Fundamentals Of Biochemistry Life At The Molecular Level

ISBN: 9781118918401

5th Edition

Authors: Donald Voet, Judith G Voet, Charlotte W Pratt

Question Posted: