The figure below are SDS PAGE gels for proteins. The one on the left is the published molecular weight markers from the manufacturer, and the one on the right is your gel, in which lane 1 is the same molecular weight standards that were used by the manufacturer. What is the approximate molecular weight of protein A? 170kD 68kD 41kD The following peptides were measured for a longer sequence that you are interested in knowing (from N to C terminus). What is the correct sequence of the complete protein? CVVYLIVAF AQVGCDP YLIVAFVLM CDPRCVV VAFVLMN AQVGCDPRCVVYLIVAFVLMN VAFVLMNCDPRCVVYLIVAFVLMAQVGCDPCVVYLIVAF CVVYLIVAFVAFVLMNCDPRCVVYLIVAFVLM CVVYLIVAFVAFVLMNCDPRCVV You have a linear chromosome with 122,342 bases in the sequence. How many phosphodiester bonds are there in the chromosome? 122,342 244,684 61,171 122,341 Approximately how many protein coding "genes" are there in your kidney cells? 2 million 200,000 20,000 2,000 200