Answered step by step
Verified Expert Solution
Link Copied!

Question

1 Approved Answer

The following peptides were measured for a longer sequence that you are interested in knowing (from N to C terminus). What is the correct sequence

image text in transcribed

image text in transcribed

The following peptides were measured for a longer sequence that you are interested in knowing (from N to C terminus). What is the correct sequence of the complete protein? CVVYLIVAF AQVGCDP YLIVAFVLM CDPRCVV VAFVLMN AQVGCDPRCVVYLIVAFVLMN VAFVLMNCDPRCVVYLIVAFVLMAQVGCDPCVVYLIVAF CVVYLIVAFVAFVLMNCDPRCVVYLIVAFVLM CVVYLIVAFVAFVLMNCDPRCVV The figure below are SDS PAGE gels for proteins. The one on the left is the published molecular weight markers from the manufacturer, and the one on the right is your gel, in which lane 1 is the same molecular weight standards that were used by the manufacturer. What is the approximate molecular weight of protein A? 170kD 68kD 41kD

Step by Step Solution

There are 3 Steps involved in it

Step: 1

blur-text-image

Get Instant Access to Expert-Tailored Solutions

See step-by-step solutions with expert insights and AI powered tools for academic success

Step: 2

blur-text-image

Step: 3

blur-text-image

Ace Your Homework with AI

Get the answers you need in no time with our AI-driven, step-by-step assistance

Get Started

Recommended Textbook for

Organic Chemistry

Authors: David R. Klein

1st edition

047175739X , 9780471757399, 978-0470917800

More Books

Students also viewed these Chemistry questions