The following sequence is part of a globular protein. Predict the secondary structure in this region. .
Question:
The following sequence is part of a globular protein. Predict the secondary structure in this region.
. . . RRPVVLMAACLRPVVFITYGDGGTYYHWYH . . .
Fantastic news! We've Found the answer you've been seeking!
Step by Step Answer:
Answer rating: 40% (5 reviews)
RRPVVLMAACLRPVVFITYGDGGTYYHWYH Its not possible to predict the exact secondary structure of this reg...View the full answer
Answered By
Shristi Singh
A freshman year metallurgy and material science student in India.
4.80+
2+ Reviews
10+ Question Solved
Related Book For
Biochemistry Concepts And Connections
ISBN: 9780134641621
2nd Edition
Authors: Dean Appling, Spencer Anthony-Cahill, Christopher Mathews
Question Posted:
Students also viewed these Sciences questions
-
Explain the following three observations. (a) Silk, like most polypeptides with sheet structures, is water insoluble. (b) Globular proteins such as myoglobin generally dissolve readily in water. (c)...
-
The protein ribonuclease A in its native, or most stable, form is folded into a compact globular shape: Native ribonuclease A (a) Does the native form have a lower or higher free energy than the...
-
In Problems, assume that the shaded region is part of a vertical side of a tank with water (δ = 62.4 pounds per cubic foot) at the level shown. Find the total force exerted by the water...
-
John Black is considering to purchasing a land from Real Estate Ltd for $1,000,000. The terms of the agreement are, 10% down payment, and the balance is to be repaid at 20% interest for duration of...
-
How can personal selling be used to build long-term customer relationships?
-
Use the transition matrix in Table 21.1 and software on the authors web site to calculate the transition matrix over 1.25 years.
-
What are four common objectives for analyzing a business's financial information?
-
Ming Companys chart of accounts includes the following selected accounts. 101 Cash 201........Accounts Payable 120 Merchandise Inventory...306 T. Ming, Drawing 130 Prepaid Insurance.....505 Cost of...
-
Exercise 11-5 (Algo) Accounting rate of return LO P2 Information for two alternative projects involving machinery investments follows: Project 1 Project 2 Initial investment $ (135,000) $ (105,000)...
-
Why does it make biochemical sense that chaperones recognize hydrophobic surface area? What catastrophic event are chaperones meant to prevent in cells?
-
Shown below are two cartoon views of the small globular protein StrepG in which an a helix is packed against a four-strand sheet. The sheet is made up of two -hairpins (a b-hairpin is a -turn-...
-
Six identical capacitors with capacitance C are connected as shown in FIGURE P26.60. a. What is the equivalent capacitance of these six capacitors? b. What is the potential difference between points...
-
Which of the theories of comparative advantage could explain why the United States exports computers to Japan at the same time that it imports computers from Japan? Explain.
-
If commercial policy can benefit U.S. industry, why would any U.S. resident oppose such policies? Find two newspaper articles illustrating opposition to commercial policies and summarize their...
-
Interpreting credit terms Interpret the meaning of the following credit terms. a. 2/10, n/60 b. 2/EOM,n/60 c. 3/10, n/30 d. 2/10, n/30
-
Identifying special journals Steele Manufacturing uses special journals in its accounting system. Indicate the journal that would be used for each of the following transactions. (Hint: Use Exhibit...
-
When a company uses an accounts receivable subsidiary ledger, it must make one entry into the individual account of the subsidiary ledger and another entry into the accounts receivable account of the...
-
In an agricultural study done to examine the impact of using a new mix of pesticides on the Canadian canola crop, a sample of 459 farms using the new pesticide mix and a sample of 295 farms using a...
-
l ask this second time correnct answer is 38,01 can we look pls Consider a non-conducting rod of length 8.8 m having a uniform charge density 4.5 nC/m. Find the electric potential at P, a...
-
What is the advantage of having mobile electron carriers in addition to large membrane-bound complexes of carriers?
-
Cytochrome oxidase and succinate-CoQ oxidoreductase are isolated from mitochondria and are incubated in the presence of oxygen, along with cytochrome c, coenzyme Q, and succinate. What is the overall...
-
Do all the respiratory complexes generate enough energy to phosphorylate ADP to ATP?
-
a. Consider a five-year, $1,000 bond with a 5% coupon rate and semiannual coupons. If this bond is currently trading for a price of $957.35, what is the bond's yield to maturity? b. Consider again...
-
please help me to make transmittal as supply chain manager. Transmittal document (Optional): This memo or letter is no more than one page in length, and it is to be addressed to the individual who...
-
Explain the six (6) negative externalities/external costs that are associated with the transportation industry, use appropriate examples Your arguments should be discussed across modes
Study smarter with the SolutionInn App