Why does it make biochemical sense that chaperones recognize hydrophobic surface area? What catastrophic event are chaperones
Question:
Why does it make biochemical sense that chaperones recognize hydrophobic surface area? What catastrophic event are chaperones meant to prevent in cells?
Fantastic news! We've Found the answer you've been seeking!
Step by Step Answer:
Answer rating: 50% (4 reviews)
Chaperones are specialized proteins that assist other proteins in folding correctly and preventing t...View the full answer
Answered By
Nazrin Ziad
I am a post graduate in Zoology with specialization in Entomology.I also have a Bachelor degree in Education.I posess more than 10 years of teaching as well as tutoring experience.I have done a project on histopathological analysis on alcohol treated liver of Albino Mice.
I can deal with every field under Biology from basic to advanced level.I can also guide you for your project works related to biological subjects other than tutoring.You can also seek my help for cracking competitive exams with biology as one of the subjects.
3.30+
2+ Reviews
10+ Question Solved
Related Book For
Biochemistry Concepts And Connections
ISBN: 9780134641621
2nd Edition
Authors: Dean Appling, Spencer Anthony-Cahill, Christopher Mathews
Question Posted:
Students also viewed these Sciences questions
-
Managing Scope Changes Case Study Scope changes on a project can occur regardless of how well the project is planned or executed. Scope changes can be the result of something that was omitted during...
-
Why does it make sense to think of the return on a stock investment as a random variable? Does it make sense to think of the return on a bond investment that way? How about an investment in a savings...
-
Why does it make little sense to look for heterogeneity of effect sizes in this example? Bauer and Döpfmer (1999) examined the efficacy of lithium as an augmentation to conventional...
-
101, 115, 143, 106, 100, 142, 157, 163, 155, 141, 145, 153, 152, 147, 143, 115, 164, 160, 147, 150 (90%) Find the confidence interval of the median, indicated in parentheses, for the set of data.
-
How does bootstrap financing fit into the strategic plan of a new venture?
-
Suppose that a bank has a total of $10 million of small exposures of a certain type. The one-year probability of default is 1% and the recovery rate averages 40%. Estimate the 99.5% one-year credit...
-
Which accounting concept is being applied when comparative financial statements are prepared to provide useful information for statement users?
-
Three years ago. Karen Suez and her brother-in-law Reece Jones opened Glgasales Department Store. For the first 2 years, business was good, but the following condensed income statement results for...
-
On October 1, 2024, Splish Brothers Company establishes a petty cash fund by issuing a cheque for $275 to Charles Wood, the custodian of the petty cash fund. On October 31, 2024, Charles Wood...
-
In most cases, mutations in the core of a protein that replace a smaller nonpolar side chain in the wild-type (e.g., Ala, Val) with a larger nonpolar side chain (e.g., Leu, Ile, Phe, Trp) in the...
-
The following sequence is part of a globular protein. Predict the secondary structure in this region. . . . RRPVVLMAACLRPVVFITYGDGGTYYHWYH . . .
-
The population of random, two-digit numbers ranges from 00 to 99, has = 49.50 and = 28.87. A statistician takes a random sample from this population and wants to see if his sample is...
-
The following deficiency finding is included in an interim audit report prepared during the course of the audit: Controls over the billing of charges for parts-repair work. Current procedures provide...
-
Why would Hernando de Sotos suggestions, if implemented, stimulate economic growth?
-
Why must voluntary trade between two countries be mutually beneficial?
-
Explain how foreign aid and welfare programs create disincentives to work, produce, and generally improve economic conditions.
-
Why do countries need a system of well-defined and enforced private property rights to succeed and grow?
-
You have a random sample of 10 population members from each of two normal populations, and you want to set up a test using the following hypotheses: H 0 : 1 2 = 0 H a : 1 2 0 a. Using a...
-
A simple random sample of 220 university students were asked what pasta they usually order and with which sauce. The preferences of these respondents are summarised below: Sauce Bolognese Pasta...
-
Is there a fundamental difference between the one- and two-electron reactions in the electron transport chain?
-
Why do the electron-transfer reactions of the cytochromes differ in standard reduction potential, even though all the reactions involve the same oxidationreduction reaction of iron?
-
What is the advantage of having a Q cycle in electron transport in spite of its complexity?
-
A 1 6 - year, 8 % semiannual coupon bond with a face value of $ 1 , 0 0 0 has YTM of 7 . 2 % . The bond may be called in 5 years at a call price of $ 1 , 0 4 0 . Find bond's nominal yield to call. (...
-
An auto dealership is advertising that a new car with a sticker price of $ 3 4 , 8 4 8 is on sale for $ 2 5 , 9 9 5 if payment is made in full, or it can be financed at 0 % interest for 7 2 months...
-
A manufacturing company is considering upgrading an existing machine. The cost of the new machine is 950,000 TL and the installation cost is 50,000 dollars. The current machine is sold for $ 200,000...
Study smarter with the SolutionInn App