What kinds of organisms can fix nitrogen? Which ones cannot?
Question:
What kinds of organisms can fix nitrogen? Which ones cannot?
Fantastic news! We've Found the answer you've been seeking!
Step by Step Answer:
Answer rating: 0% (2 reviews)
Nitrogenfixing bacteria symbiotic organism...View the full answer
Answered By
Mwangi Clement
I am a tried and tested custom essay writer with over five years of excellent essay writing. In my years as a custom essay writer, I have completed more than 2,000 custom essays in a diverse set of subjects. When you order essays from me, you are working with one of the best paper writers on the web. One of the most common questions I get from customers is: “can you write my essay?” Upon hearing that request, my goal is to provide the best essays and overall essay help available on the web. I have worked on papers in subjects such as Nursing and Healthcare, English Literature, Sociology, Philosophy, Psychology, Education, Religious Studies, Business, Biological Sciences, Communications and Media, Physical Sciences, Marketing and many others. In these fields, my specialties lie in crafting professional standard custom writings. These include, but are not limited to: research papers, coursework, assignments, term papers, capstone papers, reviews, summaries, critiques, proofreading and editing, and any other college essays.
My extensive custom writings experience has equipped me with a set of skills, research abilities and a broad knowledge base that allows me to navigate diverse paper requirements while keeping my promise of quality. Furthermore, I have also garnered excellent mastery of paper formatting, grammar, and other relevant elements. When a customer asks me to write their essay, I will do my best to provide the best essay writing service possible. I have satisfactorily offered my essay writing services for High School, Diploma, Bachelors, Masters and Ph.D. clients.
I believe quality, affordability, flexibility, and punctuality are the principal reasons as to why I have risen among the best writers on this platform. I deliver 100% original papers that pass all plagiarism check tests (Turnitin, Copyscape, etc.). My rates for all papers are relatively affordable to ensure my clients get quality essay writing services at reasonable prices.
4.50+
5+ Reviews
14+ Question Solved
Related Book For
Biochemistry
ISBN: 9781305961135
9th Edition
Authors: Mary K. Campbell, Shawn O. Farrell, Owen M. McDougal
Question Posted:
Students also viewed these Sciences questions
-
Cyanobacteria are a large group of prokaryotic organisms. Cyanobacteria are found in marine microbial mats that include many species of Eukaryota and prokaryotic organisms that can participate in...
-
Nitrogen is a vital component of proteins and nucleic acids, and thus is necessary for life. The atmosphere is composed of roughly 80% N2, but most organisms cannot directly utilize N 2 for...
-
1) The strands of double stranded DNA are arranged in ___________fashion and form a__________ A) parallel.......Beta Pleated Sheet B) Anti-Parallel........Beta Pleated Sheet C)...
-
Linking every transport stakeholder together and ensuring seamless travel across Europe is a dream. With this objective, Amadeus, a leading global travel technology player, initiated a novel idea of...
-
Green River Company is preparing its master budget for 2012. Relevant data pertaining to its sales, production, and direct materials budgets are as follows. Sales: Sales for the year are expected to...
-
Solve the system by substitution. x - 5y = 8 x = 6y
-
A gang of workers normally consist of 30 men, 15 women and 10 boys. They are paid at standard hourly rates as follows: Re Men 0.80 Women 0.60 Boys 0.40 In a normal working week of 40 hours, the gang...
-
Why is it important for the functional areas to be involved in the project from the time of the original proposal?
-
Explain the following aspects in analysis and discussion. Explain the advantages and disadvantages of renting vs buying a house/apartment. Discuss the types of mortgages and loan terms. (Conventional...
-
What is the Haber process?
-
How does the production of sugars by tropical plants differ from the same reactions in the Calvin cycle?
-
In Problem, find the indicated derivatives and simplify. 31 dp for P 1- 9 aq
-
1.1 Indonesia is it potential as a market for Apple? 2.1 Examination of Apple's entry strategy into the international market? 2.2 Evaluation of the entry mode(s) employed by Apple and their...
-
Dynamic, a global media agency, has recently taken over MediaHype, a local agency in Melbourne, to expand its Australian operations. Jeff Tan, a Chinese national, has been appointed to head the new...
-
Linear optimization models play a crucial role in improving supply chain management efficiency, both in physical and abstract network problems. Three ways they can be applied are through optimizing...
-
When I consider optimizing the portfolio allocation for both my 403(b) and CALSTRS retirement accounts, I find it crucial to employ a well-structured model to ensure that my investments align with my...
-
How can you use your understanding of diversity to develop your relationship-building skills in your healthcare career?,Explain ways in which religion can help or hinder individuals as they build...
-
Verify (17.64) for the PPP F matrix elements.
-
Global.asax is used for: a. declare application variables O b. all other answers are wrong O c. declare global variables O d. handle application events
-
Why does it make biochemical sense that chaperones recognize hydrophobic surface area? What catastrophic event are chaperones meant to prevent in cells?
-
The following sequence is part of a globular protein. Predict the secondary structure in this region. . . . RRPVVLMAACLRPVVFITYGDGGTYYHWYH . . .
-
Shown below are two cartoon views of the small globular protein StrepG in which an a helix is packed against a four-strand sheet. The sheet is made up of two -hairpins (a b-hairpin is a -turn-...
-
Fig 1. Rolling a 4 on a D4 A four sided die (D4), shaped like a pyramid (or tetrahedron), has 4 flat surfaces opposite four corner points. A number (1, 2, 3, or 4) appears close to the edge of each...
-
I just need help with question #4 please! Thank you! Windsor Manufacturing uses MRP to schedule its production. Below is the Bill of Material (BOM) for Product A. The quantity needed of the part...
-
(25) Suppose that we have an economy consisting of two farmers, Cornelius and Wheaton, who unsurprisingly farm corn c and wheat w, respectively. Assume that both farmers produce their crop of choice...
Study smarter with the SolutionInn App